ADM angl Adrenomedullin bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 185 aminokislot a molekulyarna masa 20 420 4 ADMNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB2FLY 2L7S 4RWFIdentifikatoriSimvoliADM Adm AM PAMP adrenomedullinZovnishni ID OMIM 103275 MGI 108058 HomoloGene 873 GeneCards ADMOntologiya genaMolekulyarna funkciya signaling receptor binding hormone activity adrenomedullin receptor binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta extracellular region citoplazma extracellular spaceBiologichnij proces negative regulation of cell population proliferation response to hypoxia neural tube closure branching involved in labyrinthine layer morphogenesis antibacterial humoral response GO 0051636 defense response to Gram negative bacterium receptor internalization krovoobig GO 0072468 Signalna transdukciya animal organ regeneration cell cell signaling response to lipopolysaccharide vascular associated smooth muscle cell development GO 0051637 defense response to Gram positive bacterium positive regulation of cytosolic calcium ion concentration vaskulogenez negative regulation of vasoconstriction G protein coupled receptor internalization cAMP mediated signaling calcium ion homeostasis response to starvation heart development regulation of the force of heart contraction positive regulation of apoptotic process response to yeast response to cold positive regulation of vasculogenesis neuron projection regeneration hormone secretion antifungal humoral response positive regulation of cell population proliferation response to glucocorticoid developmental growth GO 0010260 starinnya lyudini progesterone biosynthetic process negative regulation of vascular permeability androgen metabolic process response to insulin positive regulation of angiogenesis response to organic substance odontogenesis of dentin containing tooth spongiotrophoblast layer development female pregnancy response to wounding cAMP biosynthetic process antimicrobial humoral immune response mediated by antimicrobial peptide regulation of systemic arterial blood pressure positive regulation of heart rate regulation of urine volume G protein coupled receptor signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathway regulation of signaling receptor activity amylin receptor signaling pathway adrenomedullin receptor signaling pathway inflammatory response positive regulation of progesterone biosynthetic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez133 11535Ensembl ENSG00000148926 ENSMUSG00000030790UniProt P35318 P97297RefSeq mRNK NM 001124NM 009627RefSeq bilok NP 001115NP 033757Lokus UCSC Hr 11 10 31 10 31 MbHr 7 110 23 110 23 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFLA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Sekretovanij nazovni Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Samson W K 1998 Proadrenomedullin derived peptides Front Neuroendocrinol 19 100 127 PubMed DOI 10 1006 frne 1998 0164 Champion H C Nussdorfer G G Kadowitz P J 1999 Structure activity relationships of adrenomedullin in the circulation and adrenal gland Regul Pept 85 1 8 PubMed DOI 10 1016 S0167 0115 99 00025 7 Lucyk S Taha H Yamamoto H Miskolzie M Kotovych G 2006 NMR conformational analysis of proadrenomedullin N terminal 20 peptide a proangiogenic factor involved in tumor growth Biopolymers 81 295 308 PubMed DOI 10 1002 bip 20418Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 259 angl Arhiv originalu za 23 lipnya 2017 Procitovano 8 veresnya 2017 UniProt P35318 angl Arhiv originalu za 17 veresnya 2017 Procitovano 8 veresnya 2017 Div takozh red Hromosoma 11 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Adrenomedulin amp oldid 35840930