PDGFRB angl Platelet derived growth factor receptor beta bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi 5 Dovzhina polipeptidnogo lancyuga bilka stanovit 1 106 aminokislot a molekulyarna masa 123 968 6 PDGFRBNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1GQ5 1H9O 1SHA 2L6W 2PLD 2PLE 3MJGIdentifikatoriSimvoliPDGFRB CD140B IBGC4 IMF1 JTK12 PDGFR PDGFR 1 PDGFR1 KOGS PENTT platelet derived growth factor receptor betaZovnishni ID OMIM 173410 MGI 97531 HomoloGene 1960 GeneCards PDGFRBPov yazani genetichni zahvoryuvannyagostrij miyeloyidnij lejkoz juvenile myelomonocytic leukemia infantile myofibromatosis Kosaki overgrowth syndrome acroosteolysis keloid like lesions premature aging syndrome 1 Reaguye na spolukucediranib crenolanib linifanib Masitinib Nintedanib Pazopanib semaxanib sunitinib vatalanib Nintedanib imatinib Masitinib Bekaplermin famitinib orantinib PD166285 MLN 518 imatinib mesylate 2 Ontologiya genaMolekulyarna funkciya vascular endothelial growth factor binding kinase activity platelet derived growth factor activated receptor activity transmembrane receptor protein tyrosine kinase activity signaling receptor binding ATP binding protein kinase activity platelet derived growth factor binding platelet activating factor receptor activity transferase activity platelet derived growth factor receptor binding GO 0001948 GO 0016582 protein binding protein tyrosine kinase activity protein kinase binding platelet derived growth factor beta receptor activity nucleotide binding phosphatidylinositol 3 kinase binding phosphatidylinositol 4 5 bisphosphate 3 kinase activity enzyme bindingKlitinna komponenta citoplazma membrana focal adhesion klitinne yadro apical plasma membrane lizosoma ekzosoma integral component of membrane klitinna membrana lysosomal lumen intrinsic component of plasma membrane GO 0016023 cytoplasmic vesicle cell surface kompleks Goldzhi integral component of plasma membrane vnutrishnoklitinna membranna organela receptor complexBiologichnij proces positive regulation of MAP kinase activity positive regulation of phospholipase C activity cell migration involved in vasculogenesis cardiac myofibril assembly positive regulation of smooth muscle cell migration protein phosphorylation response to lipid positive regulation of phosphoprotein phosphatase activity positive regulation of reactive oxygen species metabolic process metanephric glomerular mesangial cell proliferation involved in metanephros development positive regulation of ERK1 and ERK2 cascade cell chemotaxis inner ear development metanephric S shaped body morphogenesis positive regulation of mitotic nuclear division platelet derived growth factor receptor beta signaling pathway positive regulation of collagen biosynthetic process phosphatidylinositol metabolic process transmembrane receptor protein tyrosine kinase signaling pathway cell migration involved in coronary angiogenesis metanephric comma shaped body morphogenesis positive regulation of chemotaxis positive regulation of DNA biosynthetic process protein autophosphorylation platelet derived growth factor receptor signaling pathway response to toxic substance positive regulation of metanephric mesenchymal cell migration by platelet derived growth factor receptor beta signaling pathway regulation of actin cytoskeleton organization response to retinoic acid fosforilyuvannya response to hyperoxia retina vasculature development in camera type eye metanephric glomerulus morphogenesis metanephric mesenchymal cell migration Zagoyennya ran cellular response to platelet derived growth factor stimulus negative regulation of apoptotic process response to fluid shear stress response to estrogen hemotaksis metanephric mesenchyme development response to hydrogen peroxide positive regulation of smooth muscle cell proliferation response to estradiol GO 0007243 intracellular signal transduction GO 1904578 response to organic cyclic compound smooth muscle cell chemotaxis positive regulation of cell migration aorta morphogenesis MAPK cascade positive regulation of phosphatidylinositol 3 kinase activity metanephric glomerular capillary formation multicellular organism development positive regulation of calcium ion import glycosaminoglycan biosynthetic process positive regulation of cell population proliferation positive regulation of cell proliferation by VEGF activated platelet derived growth factor receptor signaling pathway positive regulation of phosphatidylinositol 3 kinase signaling peptidyl tyrosine phosphorylation cell migration GO 0072468 signalna transdukciya positive regulation of Rho protein signal transduction G protein coupled receptor signaling pathway phosphatidylinositol phosphate biosynthetic process positive regulation of hepatic stellate cell activation positive regulation of fibroblast proliferation positive regulation of apoptotic process GO 0010260 starinnya lyudini male gonad development lung growth negative regulation of platelet derived growth factor receptor beta signaling pathway phosphatidylinositol mediated signaling positive regulation of protein kinase B signaling hematopoietic progenitor cell differentiation positive regulation of MAPK cascadeDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5159 18596Ensembl ENSG00000113721 ENSMUSG00000024620UniProt P09619 P05622RefSeq mRNK NM 002609 NM 001355016 NM 001355017NM 001146268 NM 008809RefSeq bilok NP 002600 NP 001341945 NP 001341946NP 001139740 NP 032835Lokus UCSC Hr 5 150 11 150 16 MbHr 18 61 18 61 22 MbPubMed search 3 4 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTF VLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFC THNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCR VTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVD SDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYP RKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLW FKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFH EDAEVQLSFQLQINVPVRVLELSESHPDSGEQTVRCRGRGMPQPNIIWSA CRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFEVVSTLRLQHV DRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLI ILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMS ELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTF LQHHSDKRRPPSAELYSNALPVGLPLPSHVSLTGESDGGYMDMSKDESVD YVPMLDMKGDVKYADIESSNYMAPYDNYVPSAPERTCRATLINESPVLSY MDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARD IMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPP FSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRS PLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLN EVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAE AEDSFL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz receptoriv bilkiv rozvitku tirozinovih proteyinkinaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak hemotaksis alternativnij splajsing polimorfizm Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u klitinnij membrani membrani citoplazmatichnih vezikulah lizosomi Literaturared The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Roberts W M Look A T Roussel M F Sherr C J 1988 Tandem linkage of human CSF 1 receptor c fms and PDGF receptor genes Cell 55 655 661 PMID 2846185 DOI 10 1016 0092 8674 88 90224 3 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Kazlauskas A Cooper J A 1989 Autophosphorylation of the PDGF receptor in the kinase insert region regulates interactions with cell proteins Cell 58 1121 1133 PMID 2550144 DOI 10 1016 0092 8674 89 90510 2 Sorkin A Westermark B Heldin C H Claesson Welsh L 1991 Effect of receptor kinase inactivation on the rate of internalization and degradation of PDGF and the PDGF beta receptor J Cell Biol 112 469 478 PMID 1846866 DOI 10 1083 jcb 112 3 469 Kazlauskas A Kashishian A Cooper J A Valius M 1992 GTPase activating protein and phosphatidylinositol 3 kinase bind to distinct regions of the platelet derived growth factor receptor beta subunit Mol Cell Biol 12 2534 2544 PMID 1375321 DOI 10 1128 MCB 12 6 2534Primitkired Zahvoryuvannya genetichno pov yazani z PDGFRB pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Platelet derived growth factor receptor beta pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8804 angl Arhiv originalu za 27 bereznya 2015 Procitovano 5 veresnya 2017 UniProt P09619 angl Arhiv originalu za 26 serpnya 2017 Procitovano 5 veresnya 2017 Div takozhred Hromosoma 5 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title PDGFRB amp oldid 35692658