ATP8 angl ATP synthase F0 subunit 8 bilok yakij koduyetsya odnojmennim genom yakij u lyudej ye chastinoyu mitohondrialnoyi DNK 2 Dovzhina polipeptidnogo lancyuga bilka stanovit 68 aminokislot a molekulyarna masa 7 992 3 ATP8IdentifikatoriSimvoliATP8 ATPase8 MTMT ATP synthase F0 subunit 8Zovnishni ID OMIM 516070 HomoloGene 124425 GeneCards ATP8Ontologiya genaMolekulyarna funkciya ATPase activity GO 0022891 transmembrane transporter activity proton transmembrane transporter activityKlitinna komponenta integral component of membrane mitohondrialna vnutrishnya membrana mitochondrial proton transporting ATP synthase complex coupling factor F o mitohondriya membrana mitohondrialna membrana proton transporting ATP synthase complex coupling factor F o mitochondrial proton transporting ATP synthase complexBiologichnij proces mitochondrial ATP synthesis coupled proton transport ATP synthesis coupled proton transport ion transport ATP biosynthetic process cristae formationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez4509 n dEnsembl ENSG00000228253 n dUniProt P03928 n dRefSeq mRNK n dn dRefSeq bilok n dn dLokus UCSC n dn dPubMed search 1 n dVikidaniDiv Red dlya lyudej Poslidovnist aminokislot1020304050MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQSC Cisteyin E Glutaminova kislota F Fenilalanin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak transport ioniv transport sintez ATF transport protoniv acetilyuvannya Lokalizovanij u membrani mitohondriyi Literatura RedaguvatiHorai S Hayasaka K Kondo R Tsugane K Takahata N 1995 Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs Proc Natl Acad Sci U S A 92 532 536 PubMed DOI 10 1073 pnas 92 2 532 Moilanen J S Finnila S Majamaa K 2003 Lineage specific selection in human mtDNA lack of polymorphisms in a segment of MTND5 gene in haplogroup J Mol Biol Evol 20 2132 2142 PubMed DOI 10 1093 molbev msg230 Ingman M Kaessmann H Paeaebo S Gyllensten U 2000 Mitochondrial genome variation and the origin of modern humans Nature 408 708 713 PubMed DOI 10 1038 35047064 Ingman M Gyllensten U 2003 Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines Genome Res 13 1600 1606 PubMed DOI 10 1101 gr 686603 Rieder M J Taylor S L Tobe V O Nickerson D A 1998 Automating the identification of DNA variations using quality based fluorescence re sequencing analysis of the human mitochondrial genome Nucleic Acids Res 26 967 973 PubMed DOI 10 1093 nar 26 4 967Primitki Redaguvati Human PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7415 angl Procitovano 12 veresnya 2017 UniProt P03928 angl Arhiv originalu za 8 veresnya 2017 Procitovano 12 veresnya 2017 Div takozh RedaguvatiMitohondrialna DNK nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska skoristajtesya pidkazkoyu ta rozstavte posilannya vidpovidno do prijnyatih rekomendacij Otrimano z https uk wikipedia org w index php title ATP8 amp oldid 35339869
